PDB entry 1tn3

View 1tn3 on RCSB PDB site
Description: the c-type lectin carbohydrate recognition domain of human tetranectin
Class: lectin
Keywords: tetranectin, plasminogen binding, kringle 4, c-type lectin, carbohydrate recognition domain
Deposited on 1997-11-06, released 1998-05-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tetranectin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05452 (0-136)
  Domains in SCOPe 2.03: d1tn3a_
• Heterogens: CA, SO4, EOH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tn3A (A:)
  alqtvclkgtkvhmkcflaftqtktfheasedcisrggtlstpqtgsendalyeylrqsv
  gneaeiwlglndmaaegtwvdmtgariayknweteitaqpdggktencavlsgaangkwf
  dkrcrdqlpyicqfgiv