Lineage for d1afa11 (1afa 1:105-226)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85600Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 85601Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 85602Family d.169.1.1: C-type lectin domain [56437] (15 proteins)
  6. 85638Protein Mannose-binding protein A, lectin domain [56458] (2 species)
  7. 85641Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (24 PDB entries)
  8. 85689Domain d1afa11: 1afa 1:105-226 [42402]
    Other proteins in same PDB: d1afa12, d1afa22, d1afa32

Details for d1afa11

PDB Entry: 1afa (more details), 2 Å

PDB Description: structural basis of galactose recognition in c-type animal lectins

SCOP Domain Sequences for d1afa11:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afa11 d.169.1.1 (1:105-226) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdqpddwyghglgggedcvtivdnglwndiscqashtavcef
pa

SCOP Domain Coordinates for d1afa11:

Click to download the PDB-style file with coordinates for d1afa11.
(The format of our PDB-style files is described here.)

Timeline for d1afa11: