Lineage for d7q77a_ (7q77 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928145Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)
  7. 2928150Species Cow (Bos taurus) [TaxId:9913] [54079] (212 PDB entries)
  8. 3087217Domain d7q77a_: 7q77 A: [423534]
    automated match to d1a2wa_
    complexed with cl, na, so4

Details for d7q77a_

PDB Entry: 7q77 (more details), 1.6 Å

PDB Description: room temperature structure of rnase a at 50 mpa helium gas pressure in a sapphire capillary
PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d7q77a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7q77a_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d7q77a_:

Click to download the PDB-style file with coordinates for d7q77a_.
(The format of our PDB-style files is described here.)

Timeline for d7q77a_:

  • d7q77a_ is new in SCOPe 2.08-stable