Lineage for d8drla_ (8drl A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699500Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2699501Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. 2699739Protein automated matches [190502] (2 species)
    not a true protein
  7. 2699740Species Escherichia coli [TaxId:562] [187450] (15 PDB entries)
  8. 3087109Domain d8drla_: 8drl A: [423426]
    automated match to d2bc5a_
    complexed with hec, zn

Details for d8drla_

PDB Entry: 8drl (more details), 1.65 Å

PDB Description: zn(ii)-bound b2 dimer (h60/h100/h104) formed in cu(ii)//zn(ii) (m1 // m2) condition
PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d8drla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d8drla_ a.24.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwh
frhgfdilvgqiddalklanegkvkeaqaaaeqlkctcnhchqhyr

SCOPe Domain Coordinates for d8drla_:

Click to download the PDB-style file with coordinates for d8drla_.
(The format of our PDB-style files is described here.)

Timeline for d8drla_:

  • d8drla_ is new in SCOPe 2.08-stable