Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Snake coagglutinin beta chain [88867] (10 species) heterodimeric coagulation factors IX/X-binding protein (IX/X-BP) |
Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88868] (6 PDB entries) |
Domain d1ixxf_: 1ixx F: [42340] Other proteins in same PDB: d1ixxa_, d1ixxc_, d1ixxe_ complexed with ca |
PDB Entry: 1ixx (more details), 2.5 Å
SCOPe Domain Sequences for d1ixxf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixxf_ d.169.1.1 (F:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]} dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce fqa
Timeline for d1ixxf_: