Lineage for d1d4ea3 (1d4e A:360-505)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001255Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 3001256Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 3001257Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 3001264Protein Flavocytochrome c3 (respiratory fumarate reductase) [56432] (2 species)
    contains additional N-terminal multiheme domain
  7. 3001289Species Shewanella putrefaciens [TaxId:24] [56434] (3 PDB entries)
  8. 3001295Domain d1d4ea3: 1d4e A:360-505 [42323]
    Other proteins in same PDB: d1d4ea1, d1d4ea2
    complexed with fad, fum, hec
    has additional subdomain(s) that are not in the common domain

Details for d1d4ea3

PDB Entry: 1d4e (more details), 2.8 Å

PDB Description: crystal structure of the flavocytochrome c fumarate reductase of shewanella putrefaciens strain mr-1 complexed with fumarate
PDB Compounds: (A:) flavocytochrome c fumarate reductase

SCOPe Domain Sequences for d1d4ea3:

Sequence, based on SEQRES records: (download)

>d1d4ea3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]}
yiqahptyspaggvmiteavrgngaivvnregnrfmneittrdkasaailqqkgesaylv
fddsirkslkaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvksgkdaqf
erpdlprelvvapfyaleiapavhht

Sequence, based on observed residues (ATOM records): (download)

>d1d4ea3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]}
yiqahptyspaggvmiteavrgngaivvnregnrfmneittrdkasaailqqkgesaylv
fddsirkslkaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvsgkdaqfe
rpdlprelvvapfyaleiapavhht

SCOPe Domain Coordinates for d1d4ea3:

Click to download the PDB-style file with coordinates for d1d4ea3.
(The format of our PDB-style files is described here.)

Timeline for d1d4ea3: