Lineage for d7szla_ (7szl A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856197Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (2 families) (S)
  5. 2856217Family c.23.2.0: automated matches [196997] (1 protein)
    not a true family
  6. 2856218Protein automated matches [196998] (2 species)
    not a true protein
  7. 2856219Species Human (Homo sapiens) [TaxId:9606] [196999] (9 PDB entries)
  8. 3086419Domain d7szla_: 7szl A: [422736]
    automated match to d1t3ga_

Details for d7szla_

PDB Entry: 7szl (more details), 2.3 Å

PDB Description: crystal structure of the toll/interleukin-1 receptor domain of human il-1r10 (il-1rapl2)
PDB Compounds: (A:) X-linked interleukin-1 receptor accessory protein-like 2

SCOPe Domain Sequences for d7szla_:

Sequence, based on SEQRES records: (download)

>d7szla_ c.23.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keydaylsytkvdqdtldcdnpeeeqfalevlpdvlekhygyklfiperdlipsgtymed
ltryveqsrrliivltpdyilrrgwsifelesrlhnmlvsgeikviliectelkgkvncq
eveslkrsikllslikwkgskssklnskfwkhlvyempi

Sequence, based on observed residues (ATOM records): (download)

>d7szla_ c.23.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keydaylsytkvdqdnpeeeqfalevlpdvlekhygyklfiperdlipsgtymedltryv
eqsrrliivltpdyilrrgwsifelesrlhnmlvsgeikviliectelkgkvncqevesl
krsikllslikwkgskssklnskfwkhlvyempi

SCOPe Domain Coordinates for d7szla_:

Click to download the PDB-style file with coordinates for d7szla_.
(The format of our PDB-style files is described here.)

Timeline for d7szla_:

  • d7szla_ is new in SCOPe 2.08-stable