SCOPe 2.08: Domain d7u0nf_: 7u0n F:

Lineage for d7u0nf_ (7u0n F:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
   core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542

4. Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family)
   automatically mapped to Pfam PF09408

5. Family d.318.1.1: SARS receptor-binding domain-like [143588] (2 proteins)
   part of PfamB PB000266

6. Protein automated matches [420532] (2 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [420533] (4 PDB entries)

8. Domain d7u0nf_: 7u0n F: [422588]
   Other proteins in same PDB: d7u0na_, d7u0nb_
   automated match to d6vw1f_
   complexed with cl, edo, mg, nag, zn

Details for d7u0nf_

PDB Entry: 7u0n, 2.61 Å

PDB Description: crystal structure of chimeric omicron rbd (strain ba.1) complexed with human ace2

PDB Compounds: (F:) Spike protein S1

SCOPe Domain Sequences for d7u0nf_:

Sequence, based on SEQRES records:

>d7u0nf_ d.318.1.1 (F:) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
tnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcf
snvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynyk
yrlfrksnlkpferdisteiyqagstpcngvagfncyfplrsysfrptygvghqpyrvvv
lsfellnapatvcgpk

Sequence, based on observed residues (ATOM records):

>d7u0nf_ d.318.1.1 (F:) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
tnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcf
snvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynyk
yrlfrksnlkpferdisteiyqagstpcngvagfncyfplrsysfrptygvghqpyrvvv
lsfetvcgpk

Timeline for d7u0nf_:

• d7u0nf_ is new in SCOPe 2.08-stable