Lineage for d1ptog_ (1pto G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606368Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2606369Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2606370Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 2606492Protein Pertussis toxin, S1 subunit [56408] (1 species)
  7. 2606493Species Bordetella pertussis [TaxId:520] [56409] (3 PDB entries)
  8. 2606499Domain d1ptog_: 1pto G: [42258]
    Other proteins in same PDB: d1ptob1, d1ptob2, d1ptoc1, d1ptoc2, d1ptod_, d1ptoe_, d1ptof_, d1ptoh1, d1ptoh2, d1ptoi1, d1ptoi2, d1ptoj_, d1ptok_, d1ptol_

Details for d1ptog_

PDB Entry: 1pto (more details), 3.5 Å

PDB Description: the structure of a pertussis toxin-sugar complex as a model for receptor binding
PDB Compounds: (G:) pertussis toxin (subunit s1)

SCOPe Domain Sequences for d1ptog_:

Sequence, based on SEQRES records: (download)

>d1ptog_ d.166.1.1 (G:) Pertussis toxin, S1 subunit {Bordetella pertussis [TaxId: 520]}
dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
rsvasivgtlvrmapvvgacmarqaesseamaawserageamvlvyyesiaysf

Sequence, based on observed residues (ATOM records): (download)

>d1ptog_ d.166.1.1 (G:) Pertussis toxin, S1 subunit {Bordetella pertussis [TaxId: 520]}
dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
rsvasivgtlvrmapvvgacmarqaesseeamvlvyyesiaysf

SCOPe Domain Coordinates for d1ptog_:

Click to download the PDB-style file with coordinates for d1ptog_.
(The format of our PDB-style files is described here.)

Timeline for d1ptog_: