PDB entry 1pto

View 1pto on RCSB PDB site
Description: the structure of a pertussis toxin-sugar complex as a model for receptor binding
Class: toxin
Keywords: toxin
Deposited on 1994-03-22, released 1995-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.183
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pertussis toxin (subunit s1)
    Species: Bordetella pertussis [TaxId:520]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA34397 (Start-243)
    Domains in SCOPe 2.07: d1ptoa_
  • Chain 'B':
    Compound: pertussis toxin
    Species: Bordetella pertussis [TaxId:520]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ptob1, d1ptob2
  • Chain 'C':
    Compound: pertussis toxin
    Species: Bordetella pertussis [TaxId:520]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ptoc1, d1ptoc2
  • Chain 'D':
    Compound: pertussis toxin (subunit s4)
    Species: Bordetella pertussis [TaxId:520]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ptod_
  • Chain 'E':
    Compound: pertussis toxin (subunit s4)
    Species: Bordetella pertussis [TaxId:520]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ptoe_
  • Chain 'F':
    Compound: pertussis toxin (subunit s5)
    Species: Bordetella pertussis [TaxId:520]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ptof_
  • Chain 'G':
    Compound: pertussis toxin (subunit s1)
    Species: Bordetella pertussis [TaxId:520]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA34397 (Start-243)
    Domains in SCOPe 2.07: d1ptog_
  • Chain 'H':
    Compound: pertussis toxin (subunit s2)
    Species: Bordetella pertussis [TaxId:520]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ptoh1, d1ptoh2
  • Chain 'I':
    Compound: pertussis toxin
    Species: Bordetella pertussis [TaxId:520]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ptoi1, d1ptoi2
  • Chain 'J':
    Compound: pertussis toxin (subunit s4)
    Species: Bordetella pertussis [TaxId:520]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ptoj_
  • Chain 'K':
    Compound: pertussis toxin (subunit s4)
    Species: Bordetella pertussis [TaxId:520]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ptok_
  • Chain 'L':
    Compound: pertussis toxin (subunit s5)
    Species: Bordetella pertussis [TaxId:520]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ptol_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ptoA (A:)
    apvtspawaddppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafv
    stsssrrytevylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdty
    gdnagrilagalatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqt
    ranpnpytsrrsvasivgtlvrmapvvgacmarqaesseamaawserageamvlvyyesi
    aysf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ptoA (A:)
    dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
    vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
    alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
    rsvasivgtlvrmapvvgacmarqaesseeamvlvyyesiaysf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ptoB (B:)
    givippqeqitqhgspygrcanktraltvaelrgsgdlqeylrhvtrgwsifalydgtyl
    ggeyggvikdgtpggafdlkttfcimttrntgqpatdhyysnvtatrllsstnsrlcavf
    vrsgqpvigactspydgkywsmysrlrkmlyliyvagisvrvhvskeeqyydyedatfet
    yaltgisicnpgsslc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ptoC (C:)
    givippkalftqqggaygrcpngtraltvaelrgnaelqtylrqitpgwsiyglydgtyl
    gqayggiikdappgagfiyretfcittiyktgqpaadhyyskvtatrllastnsrlcavf
    vrdgqsvigacaspyegryrdmydalrrllymiymsglavrvhvskeeqyydyedatfqt
    yaltgislcnpaasic
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ptoD (D:)
    dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
    sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ptoE (E:)
    dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
    sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ptoF (F:)
    lpthlyknftvqelalklkgknqefcltafmsgrslvraclsdaghehdtwfdtmlgfai
    sayalksrialtvedspypgtpgdllelqicplngyce
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ptoG (G:)
    apvtspawaddppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafv
    stsssrrytevylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdty
    gdnagrilagalatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqt
    ranpnpytsrrsvasivgtlvrmapvvgacmarqaesseamaawserageamvlvyyesi
    aysf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ptoG (G:)
    dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
    vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
    alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
    rsvasivgtlvrmapvvgacmarqaesseeamvlvyyesiaysf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ptoH (H:)
    tpgivippqeqitqhgspygrcanktraltvaelrgsgdlqeylrhvtrgwsifalydgt
    ylggeyggvikdgtpggafdlkttfcimttrntgqpatdhyysnvtatrllsstnsrlca
    vfvrsgqpvigactspydgkywsmysrlrkmlyliyvagisvrvhvskeeqyydyedatf
    etyaltgisicnpgsslc
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ptoI (I:)
    givippkalftqqggaygrcpngtraltvaelrgnaelqtylrqitpgwsiyglydgtyl
    gqayggiikdappgagfiyretfcittiyktgqpaadhyyskvtatrllastnsrlcavf
    vrdgqsvigacaspyegryrdmydalrrllymiymsglavrvhvskeeqyydyedatfqt
    yaltgislcnpaasic
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ptoJ (J:)
    dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
    sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ptoK (K:)
    dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
    sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ptoL (L:)
    lpthlyknftvqelalklkgknqefcltafmsgrslvraclsdaghehdtwfdtmlgfai
    sayalksrialtvedspypgtpgdllelqicplngyce