Lineage for d1bcpg_ (1bcp G:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1939878Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1939879Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1939880Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 1940002Protein Pertussis toxin, S1 subunit [56408] (1 species)
  7. 1940003Species Bordetella pertussis [TaxId:520] [56409] (3 PDB entries)
  8. 1940007Domain d1bcpg_: 1bcp G: [42256]
    Other proteins in same PDB: d1bcpb1, d1bcpb2, d1bcpc1, d1bcpc2, d1bcpd_, d1bcpe_, d1bcpf_, d1bcph1, d1bcph2, d1bcpi1, d1bcpi2, d1bcpj_, d1bcpk_, d1bcpl_
    complexed with atp

Details for d1bcpg_

PDB Entry: 1bcp (more details), 2.7 Å

PDB Description: binary complex of pertussis toxin and atp
PDB Compounds: (G:) pertussis toxin

SCOPe Domain Sequences for d1bcpg_:

Sequence, based on SEQRES records: (download)

>d1bcpg_ d.166.1.1 (G:) Pertussis toxin, S1 subunit {Bordetella pertussis [TaxId: 520]}
dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
rsvasivgtlvrmapvvgacmarqaesseamaawserageamvlvyyesiaysf

Sequence, based on observed residues (ATOM records): (download)

>d1bcpg_ d.166.1.1 (G:) Pertussis toxin, S1 subunit {Bordetella pertussis [TaxId: 520]}
dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
rsvasivgtlvrmapvvgacmarqaesseeamvlvyyesiaysf

SCOPe Domain Coordinates for d1bcpg_:

Click to download the PDB-style file with coordinates for d1bcpg_.
(The format of our PDB-style files is described here.)

Timeline for d1bcpg_: