Lineage for d7wkqb_ (7wkq B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 3086148Species Acidimicrobiia bacterium [TaxId:2080302] [422465] (1 PDB entry)
  8. 3086161Domain d7wkqb_: 7wkq B: [422478]
    automated match to d4da9d_

Details for d7wkqb_

PDB Entry: 7wkq (more details), 2.89 Å

PDB Description: crystal structure of halohydrin dehalogenase from acidimicrobiia bacterium
PDB Compounds: (B:) halohydrin dehalogenase

SCOPe Domain Sequences for d7wkqb_:

Sequence, based on SEQRES records: (download)

>d7wkqb_ c.2.1.0 (B:) automated matches {Acidimicrobiia bacterium [TaxId: 2080302]}
krvalvgdasfyvgpslarelarrehnlvlgdpaeglvdeltalgveveavlgvrnladp
esaqklvaaaqerfgridsaaafsgrvvtgkfldstledlhsvvqgcleapyhflkavvp
vmveqgdgqvlvmtsataarpsrgaslyssaragatmmvknvaaevarngvqvnavgtnf
mdfpeflrasgandpeirarieaavplgrlgtveefasfcmpfidgtskfttgqfiay

Sequence, based on observed residues (ATOM records): (download)

>d7wkqb_ c.2.1.0 (B:) automated matches {Acidimicrobiia bacterium [TaxId: 2080302]}
krvalvgdasfyvgpslarelarrehnlvlgdpaeglvdeltalgveveavlgvrnladp
esaqklvaaaqerfgridsaaafsgrvvtgkfldstledlhsvvqgcleapyhflkavvp
vmveqgdgqvlvmtsgaslyssaragatmmvknvaaevarngvqvnavgtnfmdfpegtv
eefasfcmpfidgtskfttgqfiay

SCOPe Domain Coordinates for d7wkqb_:

Click to download the PDB-style file with coordinates for d7wkqb_.
(The format of our PDB-style files is described here.)

Timeline for d7wkqb_:

  • d7wkqb_ is new in SCOPe 2.08-stable