SCOPe 2.08: Domain d1lts.1: 1lts A:,C:

Lineage for d1lts.1 (1lts A:,C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein Heat-labile toxin, A-chain [56401] (2 species)

7. Species Escherichia coli, type IB [TaxId:562] [56402] (9 PDB entries)

8. Domain d1lts.1: 1lts A:,C: [42229]
   Other proteins in same PDB: d1ltsd_, d1ltse_, d1ltsf_, d1ltsg_, d1ltsh_

Details for d1lts.1

PDB Entry: 1lts, 1.95 Å

PDB Description: refined structure of e. coli heat labile enterotoxin, a close relative of cholera toxin

PDB Compounds: (A:) heat-labile enterotoxin, subunit a, (C:) heat-labile enterotoxin, subunit a

SCOPe Domain Sequences for d1lts.1:

Sequence; same for both SEQRES and ATOM records:

>g1lts.1 d.166.1.1 (A:,C:) Heat-labile toxin, A-chain {Escherichia coli, type IB [TaxId: 562]}
rlyradsrppdeikrsgglmprghneyfdrgtqmninlydhargtqtgfvryddgyvsts
lslrsahlagqsilsgystyyiyviatapnmfnvndvlgvysphpyeqevsalggipysq
iygwyrvnfgviderlhrnreyrdryyrnlniapaedgyrlagfppdhqawreepwihha
pqgcgXgdtcneetqnlstiylreyqskvkrqifsdyqsevdiynri

Timeline for d1lts.1:

• d1lts.1 first appeared (with stable ids) in SCOP 1.55
  
• d1lts.1 appears in SCOPe 2.07