Lineage for d1hwoa_ (1hwo A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233472Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2233473Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2233474Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2233537Protein Ebulin A-chain [56391] (1 species)
  7. 2233538Species Sambucus ebulus [TaxId:28503] [56392] (4 PDB entries)
  8. 2233540Domain d1hwoa_: 1hwo A: [42223]
    Other proteins in same PDB: d1hwob1, d1hwob2

Details for d1hwoa_

PDB Entry: 1hwo (more details), 2.9 Å

PDB Description: ebulin complexed with lactose, trigonal crystal form
PDB Compounds: (A:) ebulin

SCOPe Domain Sequences for d1hwoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwoa_ d.165.1.1 (A:) Ebulin A-chain {Sambucus ebulus [TaxId: 28503]}
idypsvsfnlagaksttyrdflknlrdrvatgtyevnglpvlrresevqvknrfvlvrlt
nyngdtvtsavdvtnlylvafsangnsyffkdatelqksnlflgttqhtlsftgnydnle
taagtrresielgpnpldgaitslwydggvarsllvliqmvpeaarfryieqevrrslqq
ltsftpnalmlsmennwssmslevqlsgdnvspfsgtvqlqnydhtprlvdnfeelykit
giaillfrcvat

SCOPe Domain Coordinates for d1hwoa_:

Click to download the PDB-style file with coordinates for d1hwoa_.
(The format of our PDB-style files is described here.)

Timeline for d1hwoa_: