Lineage for d1apga_ (1apg A:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) 
Family d.165.1.1: Plant cytotoxins [56372] (11 proteins) 
Protein Ricin A-chain [56389] (1 species) Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (11 PDB entries) 
Domain d1apga_: 1apg A: [42221]
Details for d1apga_
PDB Entry: 1apg (more details), 3 Å
PDB Description: x-ray analysis of substrate analogs in the ricin a-chain active site
SCOP Domain Sequences for d1apga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1apga_ d.165.1.1 (A:) Ricin A-chain {Castor bean (Ricinus communis)}
ifpkqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilv
elsnhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafg
gnydrleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaar
fqyiegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskf
svydvsilipiialmvyrcapppssqf
SCOP Domain Coordinates for d1apga_:
Click to download the PDB-style file with coordinates for d1apga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1apga_:
- d1apga_ first appeared (with stable ids) in SCOP 1.55
- d1apga_ appears in SCOP 1.59
- d1apga_ last appears in SCOP 1.75
View in 3D