Lineage for d1rtc__ (1rtc -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) 
Family d.165.1.1: Plant cytotoxins [56372] (11 proteins) 
Protein Ricin A-chain [56389] (1 species) Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (11 PDB entries) 
Domain d1rtc__: 1rtc - [42218]
Details for d1rtc__
PDB Entry: 1rtc (more details), 2.3 Å
PDB Description: the structure of recombinant ricin a chain at 2.3 angstroms
SCOP Domain Sequences for d1rtc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rtc__ d.165.1.1 (-) Ricin A-chain {Castor bean (Ricinus communis)}
mifpkqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfil
velsnhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfaf
ggnydrleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaa
rfqyiegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngsk
fsvydvsilipiialmvyrcapppssqf
SCOP Domain Coordinates for d1rtc__:
Click to download the PDB-style file with coordinates for d1rtc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rtc__:
- d1rtc__ first appeared (with stable ids) in SCOP 1.55
- d1rtc__ appears in SCOP 1.59
- d1rtc__ appears in the current release, SCOPe 2.08, called d1rtca1
View in 3D