Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) |
Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
Protein Mistletoe lectin I A-chain [56381] (1 species) |
Species European mistletoe (Viscum album) [TaxId:3972] [56382] (11 PDB entries) different sequence variants Uniprot P81446 1-249 Uniprot Q6ITZ3 1-240 |
Domain d2mlla_: 2mll A: [42195] Other proteins in same PDB: d2mllb1, d2mllb2 complexed with nag |
PDB Entry: 2mll (more details), 2.7 Å
SCOPe Domain Sequences for d2mlla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mlla_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album) [TaxId: 3972]} yergdldvtaqttgagyfsfitllrdyvssgsfsnaipllsqsggggeagrfvlveltns ggdgitvaidvtnlyvvayqagsqsyflsgpggrggftgttrsslpfngsypdleqyggq rkqiplgidqliqsvtalkfpgstrtgarsililiqmiseaarfnpilwrarqyinsgas flpdvymleletswgqqstqvqhstdgvfnnpialadpgggvtltnvrdviaslaimlfv c
Timeline for d2mlla_: