Lineage for d7f2ef_ (7f2e F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008871Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily)
    dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta
  4. 3008872Superfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (3 families) (S)
  5. 3008883Family d.254.1.2: Coronavirus nucleocapsid protein [143508] (2 proteins)
    C-terminal part of Pfam PF00937
  6. 3008902Protein automated matches [190565] (3 species)
    not a true protein
  7. 3008914Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [384480] (11 PDB entries)
  8. 3085481Domain d7f2ef_: 7f2e F: [421798]
    automated match to d6zcoa_
    complexed with po4

Details for d7f2ef_

PDB Entry: 7f2e (more details), 3.1 Å

PDB Description: sars-cov-2 nucleocapsid protein c-terminal domain (dodecamer)
PDB Compounds: (F:) nucleoprotein

SCOPe Domain Sequences for d7f2ef_:

Sequence, based on SEQRES records: (download)

>d7f2ef_ d.254.1.2 (F:) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
kprqkrtatkaynvtqafgrrgpeqtqgnfgdqelirqgtdykhwpqiaqfapsasaffg
msrigmevtpsgtwltytgaiklddkdpnfkdqvillnkhidaykt

Sequence, based on observed residues (ATOM records): (download)

>d7f2ef_ d.254.1.2 (F:) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
kprqkratkaynvtqafgrrgpeqtqgnfgdqelirqdykhwpqiaqfapsasaffgmsr
igmevtpsgtwltytgaiklddkqvillnkhidaykt

SCOPe Domain Coordinates for d7f2ef_:

Click to download the PDB-style file with coordinates for d7f2ef_.
(The format of our PDB-style files is described here.)

Timeline for d7f2ef_:

  • d7f2ef_ is new in SCOPe 2.08-stable