Lineage for d7ejwc_ (7ejw C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872758Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [226294] (13 PDB entries)
  8. 3085348Domain d7ejwc_: 7ejw C: [421665]
    automated match to d5exta_
    complexed with ags, gol, mg

Details for d7ejwc_

PDB Entry: 7ejw (more details), 1.98 Å

PDB Description: crystal structure of flen in complex with fleq aaa+ doamain
PDB Compounds: (C:) Transcriptional regulator FleQ

SCOPe Domain Sequences for d7ejwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ejwc_ c.37.1.0 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
lfrslvgtsraiqqvrqmmqqvadtdasvlilgesgtgkevvarnlhyhskrregpfvpv
ncgaipaelleselfghekgaftgaitsragrfelanggtlfldeigdmplpmqvkllrv
lqertfervgsnktqnvdvriiaathknlekmiedgtfredlyyrlnvfpiemaplrerv
edialllnelisrmehekrgsirfnsaaimslcrhdwpgnvrelanlverlaimhpygvi
gvgelpkkfrhv

SCOPe Domain Coordinates for d7ejwc_:

Click to download the PDB-style file with coordinates for d7ejwc_.
(The format of our PDB-style files is described here.)

Timeline for d7ejwc_:

  • d7ejwc_ is new in SCOPe 2.08-stable