Lineage for d1aihb_ (1aih B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999834Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 2999835Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 2999836Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins)
  6. 2999901Protein Integrase [56351] (1 species)
  7. 2999902Species Bacteriophage HP1 [TaxId:10690] [56352] (1 PDB entry)
  8. 2999904Domain d1aihb_: 1aih B: [42150]
    complexed with mg, so4

Details for d1aihb_

PDB Entry: 1aih (more details), 2.5 Å

PDB Description: catalytic domain of bacteriophage hp1 integrase
PDB Compounds: (B:) hp1 integrase

SCOPe Domain Sequences for d1aihb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aihb_ d.163.1.1 (B:) Integrase {Bacteriophage HP1 [TaxId: 10690]}
elaflyerdiyrllaecdnsrnpdlglivriclatgarwseaetltqsqvmpykitftnt
kskknrtvpisdelfdmlpkkrgrlfndayesfenavlraeielpkgqlthvlrhtfash
fmmnggnilvlkeilghstiemtmryahfapshlesavkfnplsnpaq

SCOPe Domain Coordinates for d1aihb_:

Click to download the PDB-style file with coordinates for d1aihb_.
(The format of our PDB-style files is described here.)

Timeline for d1aihb_: