Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein Stathmin 4 [101496] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [390534] (14 PDB entries) |
Domain d7db9e_: 7db9 E: [421302] Other proteins in same PDB: d7db9f1, d7db9f2, d7db9f3 automated match to d6qtne_ complexed with acp, ca, gdp, gtp, ic1, mes, mg |
PDB Entry: 7db9 (more details), 2.85 Å
SCOPe Domain Sequences for d7db9e_:
Sequence, based on SEQRES records: (download)
>d7db9e_ a.137.10.1 (E:) Stathmin 4 {Mouse (Mus musculus) [TaxId: 10090]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelkeeas
>d7db9e_ a.137.10.1 (E:) Stathmin 4 {Mouse (Mus musculus) [TaxId: 10090]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk eeas
Timeline for d7db9e_: