SCOPe 2.06: Domain d1a7tb_: 1a7t B:

Lineage for d1a7tb_ (1a7t B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein Zn metallo-beta-lactamase [56283] (12 species)

7. Species Bacteroides fragilis [TaxId:817] [56285] (10 PDB entries)

8. Domain d1a7tb_: 1a7t B: [42042]
   complexed with mes, na, zn

Details for d1a7tb_

PDB Entry: 1a7t, 1.85 Å

PDB Description: metallo-beta-lactamase with mes

PDB Compounds: (B:) metallo-beta-lactamase

SCOPe Domain Sequences for d1a7tb_:

Sequence; same for both SEQRES and ATOM records:

>d1a7tb_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]}
svkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqteml
vnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpehgf
tdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqttsignisdadvt
awpktldkvkakfpsaryvvpghgnyggteliehtkqivnqyiests

Timeline for d1a7tb_:

• d1a7tb_ first appeared (with stable ids) in SCOP 1.55
  
• d1a7tb_ appears in SCOPe 2.05
  
• d1a7tb_ appears in SCOPe 2.07
  
• d1a7tb_ appears in the current release, SCOPe 2.08