Lineage for d7r8vd1 (7r8v D:5-146)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883861Protein automated matches [226905] (13 species)
    not a true protein
  7. 2883864Species Chicken (Gallus gallus) [TaxId:9031] [226582] (6 PDB entries)
  8. 2883872Domain d7r8vd1: 7r8v D:5-146 [418634]
    automated match to d6upwa1
    complexed with adp, hic, mg

Details for d7r8vd1

PDB Entry: 7r8v (more details), 2.82 Å

PDB Description: cryo-em structure of the adp state actin filament
PDB Compounds: (D:) Actin, alpha skeletal muscle, intermediate form

SCOPe Domain Sequences for d7r8vd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7r8vd1 c.55.1.1 (D:5-146) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

SCOPe Domain Coordinates for d7r8vd1:

Click to download the PDB-style file with coordinates for d7r8vd1.
(The format of our PDB-style files is described here.)

Timeline for d7r8vd1:

  • d7r8vd1 is new in SCOPe 2.08-stable