Lineage for d3pvaf_ (3pva F:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36602Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 36603Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 36662Family d.153.1.3: Penicillin V acylase [56248] (1 protein)
  6. 36663Protein Penicillin V acylase [56249] (1 species)
  7. 36664Species Bacillus sphaericus [TaxId:1421] [56250] (2 PDB entries)
  8. 36674Domain d3pvaf_: 3pva F: [41859]

Details for d3pvaf_

PDB Entry: 3pva (more details), 2.8 Å

PDB Description: penicillin v acylase from b. sphaericus

SCOP Domain Sequences for d3pvaf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pvaf_ d.153.1.3 (F:) Penicillin V acylase {Bacillus sphaericus}
csslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgmgst
ditspvlydgvnekglmgamlyyatfatyadepkkgttginpvyvisqvlgncvtvddvi
ekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtnspgye
whqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkkyte
kaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydnsris
avslmaenlnsqdlitfewdrkqdikqlnqvnvm

SCOP Domain Coordinates for d3pvaf_:

Click to download the PDB-style file with coordinates for d3pvaf_.
(The format of our PDB-style files is described here.)

Timeline for d3pvaf_: