Lineage for d3pvad_ (3pva D:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily) Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) 
Family d.153.1.3: Penicillin V acylase [56248] (1 protein) Protein Penicillin V acylase [56249] (1 species) Species Bacillus sphaericus [TaxId:1421] [56250] (2 PDB entries) 
Domain d3pvad_: 3pva D: [41857]
Details for d3pvad_
PDB Entry: 3pva (more details), 2.8 Å
PDB Description: penicillin v acylase from b. sphaericus
SCOP Domain Sequences for d3pvad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pvad_ d.153.1.3 (D:) Penicillin V acylase {Bacillus sphaericus}
csslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgmgst
ditspvlydgvnekglmgamlyyatfatyadepkkgttginpvyvisqvlgncvtvddvi
ekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtnspgye
whqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkkyte
kaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydnsris
avslmaenlnsqdlitfewdrkqdikqlnqvnvm
SCOP Domain Coordinates for d3pvad_:
Click to download the PDB-style file with coordinates for d3pvad_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3pvad_:
- d3pvad_ appears in SCOP 1.57
- d3pvad_ appears in the current release, SCOPe 2.08
View in 3D
