Lineage for d7ocma2 (7ocm A:89-171)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033286Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)
  7. 3033287Species Human (Homo sapiens) [TaxId:9606] [57458] (20 PDB entries)
  8. 3033295Domain d7ocma2: 7ocm A:89-171 [418542]
    Other proteins in same PDB: d7ocma3
    automated match to d5cp9a2
    complexed with epe

Details for d7ocma2

PDB Entry: 7ocm (more details), 1.7 Å

PDB Description: k1k1h6, a potent recombinant minimal hepatocyte growth factor/scatter factor mimic
PDB Compounds: (A:) Hepatocyte growth factor alpha chain,Hepatocyte growth factor alpha chain

SCOPe Domain Sequences for d7ocma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ocma2 g.14.1.1 (A:89-171) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
ciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeggp
wcftsnpevryevcdipqcseve

SCOPe Domain Coordinates for d7ocma2:

Click to download the PDB-style file with coordinates for d7ocma2.
(The format of our PDB-style files is described here.)

Timeline for d7ocma2:

  • d7ocma2 is new in SCOPe 2.08-stable