SCOPe 2.01: Domain d2ahjc_: 2ahj C:

Lineage for d2ahjc_ (2ahj C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
   4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets

4. Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (1 family)
   duplication: contains two structural repeats

5. Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)

6. Protein Iron-containing nitrile hydratase [56211] (1 species)

7. Species Rhodococcus erythropolis [TaxId:1833] [56212] (3 PDB entries)
   also Rhodococcus sp. R312

8. Domain d2ahjc_: 2ahj C: [41773]
   Other proteins in same PDB: d2ahjb_, d2ahjd_
   complexed with dio, fe, no, so4, zn

Details for d2ahjc_

PDB Entry: 2ahj, 1.7 Å

PDB Description: nitrile hydratase complexed with nitric oxide

PDB Compounds: (C:) nitrile hydratase

SCOPe Domain Sequences for d2ahjc_:

Sequence, based on SEQRES records:

>d2ahjc_ d.149.1.1 (C:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
idhttenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvara
wtdpefrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglp
ptwyksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsq
eqlqeivtkdcligvaipqv

Sequence, based on observed residues (ATOM records):

>d2ahjc_ d.149.1.1 (C:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
idhapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqv

Timeline for d2ahjc_:

• d2ahjc_ first appeared (with stable ids) in SCOP 1.55
  
• d2ahjc_ appears in SCOP 1.75
  
• d2ahjc_ appears in SCOPe 2.02
  
• d2ahjc_ appears in the current release, SCOPe 2.08