SCOPe 2.08: Domain d7b2he2: 7b2h E:189-443

Lineage for d7b2he2 (7b2h E:189-443)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
   multihelical bundle; contains buried central helix

4. Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families)

5. Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
   C-terminal domain is all-alpha

6. Protein automated matches [315354] (4 species)
   not a true protein

7. Species Methanothermobacter marburgensis [TaxId:79929] [420104] (1 PDB entry)

8. Domain d7b2he2: 7b2h E:189-443 [417637]
   Other proteins in same PDB: d7b2ha1, d7b2hb1, d7b2hc_, d7b2hd1, d7b2he1, d7b2hf_
   automated match to d1hbnb1
   complexed with cl, com, edo, f43, gol, k, mg, peg, so4, tp7, xe

Details for d7b2he2

PDB Entry: 7b2h, 2.12 Å

PDB Description: crystal structure of the methyl-coenzyme m reductase from methanothermobacter marburgensis derivatized with xenon

PDB Compounds: (E:) Methyl-coenzyme M reductase I subunit beta

SCOPe Domain Sequences for d7b2he2:

Sequence; same for both SEQRES and ATOM records:

>d7b2he2 a.89.1.1 (E:189-443) automated matches {Methanothermobacter marburgensis [TaxId: 79929]}
gyalrnimvnhvvaatlkntlqaaalstileqtamfemgdavgafermhllglayqgmna
dnlvfdlvkangkegtvgsviadlveraledgvikvekeltdykvygtddlamwnayaaa
glmaatmvnqgaaraaqgvsstllyyndliefetglpsvdfgkvegtavgfsffshsiyg
gggpgifngnhivtrhskgfaipcvaaamaldagtqmfspeatsglikevfsqvdefrep
lkyvveaaaeiknei

Timeline for d7b2he2:

• d7b2he2 is new in SCOPe 2.08-stable