SCOPe 2.05: Domain d1koaa2: 1koa A:5915-6264

Lineage for d1koaa2 (1koa A:5915-6264)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Twitchin, kinase domain [56126] (2 species)
   CaMK group; CAMKI subfamily; serine/threonine kinase

7. Species Caenorhabditis elegans, pjk4 [TaxId:6239] [56128] (1 PDB entry)

8. Domain d1koaa2: 1koa A:5915-6264 [41642]
   Other proteins in same PDB: d1koaa1

Details for d1koaa2

PDB Entry: 1koa, 3.3 Å

PDB Description: twitchin kinase fragment (c.elegans), autoregulated protein kinase and immunoglobulin domains

PDB Compounds: (A:) twitchin

SCOPe Domain Sequences for d1koaa2:

Sequence; same for both SEQRES and ATOM records:

>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]}
ydnyvfdiwkqyypqpveikhdhvldhydiheelgtgafgvvhrvteratgnnfaakfvm
tphesdketvrkeiqtmsvlrhptlvnlhdafeddnemvmiyefmsggelfekvadehnk
msedeaveymrqvckglchmhennyvhldlkpenimfttkrsnelklidfgltahldpkq
svkvttgtaefaapevaegkpvgyytdmwsvgvlsyillsglspfggenddetlrnvksc
dwnmddsafsgisedgkdfirkllladpntrmtihqalehpwltpgnapgrdsqipssry
tkirdsiktkydawpeplpplgrisnysslrkhrpqeysirdafwdrsea

Timeline for d1koaa2:

• d1koaa2 first appeared (with stable ids) in SCOP 1.55, called d1koa_2
  
• d1koaa2 appears in SCOPe 2.04
  
• d1koaa2 appears in SCOPe 2.06
  
• d1koaa2 appears in the current release, SCOPe 2.08