Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.1: Serine/threonin kinases [56113] (21 proteins) |
Protein cAMP-dependent PK, catalytic subunit [56116] (4 species) |
Species Pig (Sus scrofa) [TaxId:9823] [56117] (3 PDB entries) |
Domain d1cmke_: 1cmk E: [41623] complexed with i i, myr, po4 |
PDB Entry: 1cmk (more details), 2.9 Å
SCOP Domain Sequences for d1cmke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cmke_ d.144.1.1 (E:) cAMP-dependent PK, catalytic subunit {Pig (Sus scrofa)} gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv khketgnhfamkildkqkvvklkqiehtlnekrilqavnfpflvkleysfkdnsnlymvm eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfatt dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
Timeline for d1cmke_: