Lineage for d1cmke_ (1cmk E:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) 
Family d.144.1.1: Serine/threonin kinases [56113] (15 proteins) 
Protein cAMP-dependent PK, catalytic subunit [56116] (3 species) 
Species Pig (Sus scrofa) [TaxId:9823] [56117] (3 PDB entries) 
Domain d1cmke_: 1cmk E: [41623]
Details for d1cmke_
PDB Entry: 1cmk (more details), 2.9 Å
PDB Description: crystal structures of the myristylated catalytic subunit of camp-dependent protein kinase reveal open and closed conformations
SCOP Domain Sequences for d1cmke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cmke_ d.144.1.1 (E:) cAMP-dependent PK, catalytic subunit {Pig (Sus scrofa)}
gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
khketgnhfamkildkqkvvklkqiehtlnekrilqavnfpflvkleysfkdnsnlymvm
eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfatt
dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
SCOP Domain Coordinates for d1cmke_:
Click to download the PDB-style file with coordinates for d1cmke_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cmke_:
- d1cmke_ appears in SCOP 1.57
- d1cmke_ appears in the current release, SCOPe 2.08
View in 3D