Lineage for d1qmzc_ (1qmz C:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) 
Family d.144.1.1: Serine/threonin kinases [56113] (16 proteins) Protein Cyclin-dependent PK (CDK, different isozymes) [56114] (1 species) Species Human (Homo sapiens) [TaxId:9606] [56115] (24 PDB entries) 
Domain d1qmzc_: 1qmz C: [41605]
Other proteins in same PDB: d1qmzb1, d1qmzb2, d1qmzd1, d1qmzd2
Details for d1qmzc_
PDB Entry: 1qmz (more details), 2.2 Å
PDB Description: phosphorylated cdk2-cyclyin a-substrate peptide complex
SCOP Domain Sequences for d1qmzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qmzc_ d.144.1.1 (C:) Cyclin-dependent PK (CDK, different isozymes) {Human (Homo sapiens)}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
SCOP Domain Coordinates for d1qmzc_:
Click to download the PDB-style file with coordinates for d1qmzc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qmzc_:
- d1qmzc_ first appeared (with stable ids) in SCOP 1.55
- d1qmzc_ appears in SCOP 1.59
- d1qmzc_ appears in the current release, SCOPe 2.08, called d1qmzc1
View in 3D
