Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.6: Arginine methyltransferase [53351] (5 proteins) lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain |
Protein automated matches [254715] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [313441] (18 PDB entries) |
Domain d6d2la_: 6d2l A: [415784] automated match to d2v7ea_ complexed with ftg, gol, so4, unx |
PDB Entry: 6d2l (more details), 2 Å
SCOPe Domain Sequences for d6d2la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d2la_ c.66.1.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcgsgilsffaaqaga rkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdiiisepmgymlfner mlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwyqpsfhgvdlsalr gaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipfkfhmlhsglvhgl afwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdtlsgtclliankrqs ydisivaqvdqtgskssnlldlknpffryt
Timeline for d6d2la_: