Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (5 families) has a circularly permuted topology |
Family d.142.2.1: ATP-dependent DNA ligase catalytic domain [56092] (2 proteins) automatically mapped to Pfam PF01068 |
Protein ATP-dependent DNA ligase, N-terminal domain [56093] (2 species) |
Species Chlorella virus PBCV-1 [TaxId:10506] [56095] (4 PDB entries) |
Domain d1fvia2: 1fvi A:2-189 [41578] Other proteins in same PDB: d1fvia1 complexed with amp, so4 |
PDB Entry: 1fvi (more details), 2 Å
SCOPe Domain Sequences for d1fvia2:
Sequence, based on SEQRES records: (download)
>d1fvia2 d.142.2.1 (A:2-189) ATP-dependent DNA ligase, N-terminal domain {Chlorella virus PBCV-1 [TaxId: 10506]} aitkpllaatleniedvqfpclatpkiagirsvkqtqmlsrtfkpirnsvmnrlltellp egsdgeisiegatfqdttsavmtghkmynakfsyywfdyvtddplkkyidrvedmknyit vhphilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykfgrstlke gillkmkq
>d1fvia2 d.142.2.1 (A:2-189) ATP-dependent DNA ligase, N-terminal domain {Chlorella virus PBCV-1 [TaxId: 10506]} aitkpllaatleniedvqfpclatpkiagirsvkqtqmlsrtfkpirnsvmnrlltellp egsdgeisiegatfqdttsavmtghakfsyywfdyvtddplkkyidrvedmknyitvhph ilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykfgrstlkegill kmkq
Timeline for d1fvia2: