SCOPe 2.08: Domain d1fvia2: 1fvi A:2-189

Lineage for d1fvia2 (1fvi A:2-189)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families)
   has a circularly permuted topology

5. Family d.142.2.1: ATP-dependent DNA ligase catalytic domain [56092] (2 proteins)
   automatically mapped to Pfam PF01068

6. Protein ATP-dependent DNA ligase, N-terminal domain [56093] (2 species)

7. Species Chlorella virus PBCV-1 [TaxId:10506] [56095] (4 PDB entries)

8. Domain d1fvia2: 1fvi A:2-189 [41578]
   Other proteins in same PDB: d1fvia1
   complexed with amp, so4

Details for d1fvia2

PDB Entry: 1fvi, 2 Å

PDB Description: crystal structure of chlorella virus dna ligase-adenylate

PDB Compounds: (A:) chlorella virus DNA ligase-adenylate

SCOPe Domain Sequences for d1fvia2:

Sequence, based on SEQRES records:

>d1fvia2 d.142.2.1 (A:2-189) ATP-dependent DNA ligase, N-terminal domain {Chlorella virus PBCV-1 [TaxId: 10506]}
aitkpllaatleniedvqfpclatpkiagirsvkqtqmlsrtfkpirnsvmnrlltellp
egsdgeisiegatfqdttsavmtghkmynakfsyywfdyvtddplkkyidrvedmknyit
vhphilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykfgrstlke
gillkmkq

Sequence, based on observed residues (ATOM records):

>d1fvia2 d.142.2.1 (A:2-189) ATP-dependent DNA ligase, N-terminal domain {Chlorella virus PBCV-1 [TaxId: 10506]}
aitkpllaatleniedvqfpclatpkiagirsvkqtqmlsrtfkpirnsvmnrlltellp
egsdgeisiegatfqdttsavmtghakfsyywfdyvtddplkkyidrvedmknyitvhph
ilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykfgrstlkegill
kmkq

Timeline for d1fvia2:

• d1fvia2 first appeared (with stable ids) in SCOP 1.55
  
• d1fvia2 appears in SCOPe 2.07