Lineage for d6b76c2 (6b76 C:164-485)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839614Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 2839666Family c.1.17.2: Nicotinate phosphoribosyltransferase C-terminal domain-like [110910] (2 proteins)
    automatically mapped to Pfam PF04095
  6. 2839691Protein automated matches [419237] (3 species)
    not a true protein
  7. 2839692Species Human (Homo sapiens) [TaxId:9606] [419806] (63 PDB entries)
  8. 2839812Domain d6b76c2: 6b76 C:164-485 [415678]
    Other proteins in same PDB: d6b76a1, d6b76b1, d6b76c1, d6b76d1
    automated match to d2h3ba2
    complexed with cvj, po4

Details for d6b76c2

PDB Entry: 6b76 (more details), 2.44 Å

PDB Description: crystal structure of human nampt in complex with nvp-lvr596
PDB Compounds: (C:) Nicotinamide phosphoribosyltransferase

SCOPe Domain Sequences for d6b76c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b76c2 c.1.17.2 (C:164-485) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsreqkkilakylletsgnldgleyklhdfgyrgvssqetagigasahlvnfkgtdtvag
lalikkyygtkdpvpgysvpaaehstitawgkdhekdafehivtqfssvpvsvvsdsydi
ynacekiwgedlrhlivsrstqapliirpdsgnpldtvlkvleilgkkfpvtenskgykl
lppylrviqgdgvdintlqeivegmkqkmwsieniafgsgggllqkltrdllncsfkcsy
vvtnglginvfkdpvadpnkrskkgrlslhrtpagnfvtleegkgdleeygqdllhtvfk
ngkvtksysfdeirknaqlnie

SCOPe Domain Coordinates for d6b76c2:

Click to download the PDB-style file with coordinates for d6b76c2.
(The format of our PDB-style files is described here.)

Timeline for d6b76c2:

  • d6b76c2 is new in SCOPe 2.08-stable