Lineage for d2scue2 (2scu E:1-238)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217508Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
    automatically mapped to Pfam PF13549
    automatically mapped to Pfam PF08442
  6. 2217509Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)
  7. 2217510Species Escherichia coli [TaxId:562] [56083] (11 PDB entries)
  8. 2217520Domain d2scue2: 2scu E:1-238 [41563]
    Other proteins in same PDB: d2scua1, d2scua2, d2scub1, d2scud1, d2scud2, d2scue1
    complexed with coa, so4

Details for d2scue2

PDB Entry: 2scu (more details), 2.3 Å

PDB Description: A detailed description of the structure of Succinyl-COA synthetase from Escherichia coli
PDB Compounds: (E:) protein (succinyl-coa ligase)

SCOPe Domain Sequences for d2scue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2scue2 d.142.1.4 (E:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

SCOPe Domain Coordinates for d2scue2:

Click to download the PDB-style file with coordinates for d2scue2.
(The format of our PDB-style files is described here.)

Timeline for d2scue2: