Lineage for d2scub2 (2scu B:1-238)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2585054Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2585055Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2585297Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
    automatically mapped to Pfam PF13549
    automatically mapped to Pfam PF08442
  6. 2585298Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (3 species)
  7. 2585299Species Escherichia coli [TaxId:562] [56083] (11 PDB entries)
  8. 2585308Domain d2scub2: 2scu B:1-238 [41562]
    Other proteins in same PDB: d2scua1, d2scua2, d2scub1, d2scud1, d2scud2, d2scue1
    complexed with coa, so4

Details for d2scub2

PDB Entry: 2scu (more details), 2.3 Å

PDB Description: A detailed description of the structure of Succinyl-COA synthetase from Escherichia coli
PDB Compounds: (B:) protein (succinyl-coa ligase)

SCOPe Domain Sequences for d2scub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2scub2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

SCOPe Domain Coordinates for d2scub2:

Click to download the PDB-style file with coordinates for d2scub2.
(The format of our PDB-style files is described here.)

Timeline for d2scub2: