SCOPe 2.08: Domain d2scub2: 2scu B:1-238

Lineage for d2scub2 (2scu B:1-238)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
   automatically mapped to Pfam PF13549
   automatically mapped to Pfam PF08442

6. Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (3 species)

7. Species Escherichia coli [TaxId:562] [56083] (11 PDB entries)

8. Domain d2scub2: 2scu B:1-238 [41562]
   Other proteins in same PDB: d2scua1, d2scua2, d2scub1, d2scud1, d2scud2, d2scue1
   complexed with coa, so4

Details for d2scub2

PDB Entry: 2scu, 2.3 Å

PDB Description: A detailed description of the structure of Succinyl-COA synthetase from Escherichia coli

PDB Compounds: (B:) protein (succinyl-coa ligase)

SCOPe Domain Sequences for d2scub2:

Sequence; same for both SEQRES and ATOM records:

>d2scub2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

Timeline for d2scub2:

• d2scub2 first appeared (with stable ids) in SCOP 1.55
  
• d2scub2 appears in SCOPe 2.07