Lineage for d1hnwh_ (1hnw H:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873626Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 873627Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 873628Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 873629Protein Ribosomal protein S8 [56049] (4 species)
  7. 873647Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 873669Domain d1hnwh_: 1hnw H: [41471]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_
    complexed with mg, tac, zn

Details for d1hnwh_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
PDB Compounds: (H:) 30S ribosomal protein S8

SCOP Domain Sequences for d1hnwh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwh_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOP Domain Coordinates for d1hnwh_:

Click to download the PDB-style file with coordinates for d1hnwh_.
(The format of our PDB-style files is described here.)

Timeline for d1hnwh_: