![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) ![]() |
![]() | Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein) |
![]() | Protein Ribosomal protein S14 [57753] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries) Uniprot P24320 |
![]() | Domain d1hnwn_: 1hnw N: [45157] Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_ complexed with mg, tac, zn |
PDB Entry: 1hnw (more details), 3.4 Å
SCOP Domain Sequences for d1hnwn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnwn_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]} arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
Timeline for d1hnwn_: