Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.135: The spindle assembly checkpoint protein mad2 [56018] (1 superfamily) core: alpha(2)-beta(2)-alpha-beta; mixed sheet: order 213 |
Superfamily d.135.1: The spindle assembly checkpoint protein mad2 [56019] (2 families) N- and C-termini undergo large conformational rearrangement upon ligand binding automatically mapped to Pfam PF02301 |
Family d.135.1.1: The spindle assembly checkpoint protein mad2 [56020] (2 proteins) |
Protein The spindle assembly checkpoint protein mad2 [56021] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [56022] (5 PDB entries) |
Domain d1duja_: 1duj A: [41449] "apo" form |
PDB Entry: 1duj (more details)
SCOPe Domain Sequences for d1duja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1duja_ d.135.1.1 (A:) The spindle assembly checkpoint protein mad2 {Human (Homo sapiens) [TaxId: 9606]} gsitlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnnv veqlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreksqkaiqdei rsvirqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnseevrlrsftt tihkvns
Timeline for d1duja_: