Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
Family c.1.17.2: Nicotinate phosphoribosyltransferase C-terminal domain-like [110910] (2 proteins) automatically mapped to Pfam PF04095 |
Protein automated matches [419237] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [419806] (63 PDB entries) |
Domain d4l4la2: 4l4l A:164-488 [413904] Other proteins in same PDB: d4l4la1, d4l4lb1 automated match to d2h3ba2 complexed with 1xc, edo, po4 |
PDB Entry: 4l4l (more details), 2.12 Å
SCOPe Domain Sequences for d4l4la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l4la2 c.1.17.2 (A:164-488) automated matches {Human (Homo sapiens) [TaxId: 9606]} nsreqkkilakylletsgnldgleyklhdfgyrgvssqetagigasahlvnfkgtdtvag lalikkyygtkdpvpgysvpaaehstitawgkdhekdafehivtqfssvpvsvvsdsydi ynacekiwgedlrhlivsrstqapliirpdsgnpldtvlkvleilgkkfpvtenskgykl lppylrviqgdgvdintlqeivegmkqkmwsieniafgsgggllqkltrdllncsfkcsy vvtnglginvfkdpvadpnkrskkgrlslhrtpagnfvtleegkgdleeygqdllhtvfk ngkvtksysfdeirknaqlnielea
Timeline for d4l4la2: