Lineage for d1c4ga4 (1c4g A:421-561)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975429Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 2975430Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins)
    Pfam PF00408
  6. 2975440Protein Phosphoglucomutase [55959] (1 species)
  7. 2975441Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55960] (6 PDB entries)
  8. 2975452Domain d1c4ga4: 1c4g A:421-561 [41311]
    Other proteins in same PDB: d1c4ga1, d1c4ga2, d1c4ga3, d1c4gb1, d1c4gb2, d1c4gb3
    complexed with co, vg1

Details for d1c4ga4

PDB Entry: 1c4g (more details), 2.7 Å

PDB Description: phosphoglucomutase vanadate based transition state analog complex
PDB Compounds: (A:) protein (alpha-d-glucose 1-phosphate phosphoglucomutase)

SCOPe Domain Sequences for d1c4ga4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4ga4 d.129.2.1 (A:421-561) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

SCOPe Domain Coordinates for d1c4ga4:

Click to download the PDB-style file with coordinates for d1c4ga4.
(The format of our PDB-style files is described here.)

Timeline for d1c4ga4: