Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.129: TBP-like [55944] (4 superfamilies) |
Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) |
Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) |
Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species) |
Species Archaeon Pyrococcus woesei [TaxId:2262] [55951] (3 PDB entries) |
Domain d1aisa2: 1ais A:93-181 [41289] Other proteins in same PDB: d1aisb1, d1aisb2 |
PDB Entry: 1ais (more details), 2.1 Å
SCOP Domain Sequences for d1aisa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aisa2 d.129.1.1 (A:93-181) TATA-box binding protein (TBP), C-terminal domain {Archaeon Pyrococcus woesei} kfkrapqidvqnmvfsgdigrefnldvvaltlpnceyepeqfpgviyrvkepksvillfs sgkivcsgakseadaweavrkllreldky
Timeline for d1aisa2: