Lineage for d7d59f_ (7d59 F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734750Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2734751Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2734802Family a.143.1.2: RPB6 [55294] (2 proteins)
  6. 2734842Protein automated matches [254699] (5 species)
    not a true protein
  7. 2734849Species Human (Homo sapiens) [TaxId:9606] [420112] (1 PDB entry)
  8. 2734850Domain d7d59f_: 7d59 F: [412425]
    Other proteins in same PDB: d7d59h_, d7d59j_, d7d59k_, d7d59l_
    automated match to d2nvqf_
    complexed with sf4, zn

Details for d7d59f_

PDB Entry: 7d59 (more details), 3.1 Å

PDB Description: cryo-em structure of human rna polymerase iii in apo state
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III subunit RPABC2

SCOPe Domain Sequences for d7d59f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d59f_ a.143.1.2 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkrittpymtkyerarvlgtralqiamcapvmvelegetdplliamkelkarkipiiirr
ylpdgsyedwgvdeliitd

SCOPe Domain Coordinates for d7d59f_:

Click to download the PDB-style file with coordinates for d7d59f_.
(The format of our PDB-style files is described here.)

Timeline for d7d59f_:

  • d7d59f_ is new in SCOPe 2.08-stable