Class a: All alpha proteins [46456] (290 folds) |
Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
Family a.143.1.2: RPB6 [55294] (2 proteins) |
Protein automated matches [254699] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [420112] (1 PDB entry) |
Domain d7d59f_: 7d59 F: [412425] Other proteins in same PDB: d7d59h_, d7d59j_, d7d59k_, d7d59l_ automated match to d2nvqf_ complexed with sf4, zn |
PDB Entry: 7d59 (more details), 3.1 Å
SCOPe Domain Sequences for d7d59f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d59f_ a.143.1.2 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qkrittpymtkyerarvlgtralqiamcapvmvelegetdplliamkelkarkipiiirr ylpdgsyedwgvdeliitd
Timeline for d7d59f_:
View in 3D Domains from other chains: (mouse over for more information) d7d59h_, d7d59j_, d7d59k_, d7d59l_ |