Lineage for d6zke11 (6zke 1:9-253)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923529Fold c.142: Nqo1 FMN-binding domain-like [142018] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2923530Superfamily c.142.1: Nqo1 FMN-binding domain-like [142019] (2 families) (S)
  5. 2923551Family c.142.1.0: automated matches [394200] (1 protein)
    not a true family
  6. 2923552Protein automated matches [394201] (3 species)
    not a true protein
  7. 2923558Species Sheep (Ovis aries) [TaxId:9940] [420084] (15 PDB entries)
  8. 2923560Domain d6zke11: 6zke 1:9-253 [412279]
    Other proteins in same PDB: d6zke12, d6zke13, d6zkeg_, d6zkej_, d6zkex_
    automated match to d7b93f1
    complexed with 3pe, amp, cdl, dcq, fes, fmn, k, myr, nai, ndp, pc1, sf4, zmp, zn

Details for d6zke11

PDB Entry: 6zke (more details), 2.6 Å

PDB Description: complex i during turnover, open2
PDB Compounds: (1:) nadh dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

SCOPe Domain Sequences for d6zke11:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zke11 c.142.1.0 (1:9-253) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
ktsfgslkdedriftnlygrhdwrlkgaqsrgdwyktkeillkgpdwilgevktsglrgr
ggagfptglkwsfmnkpsdgrpkylvvnadegepgtckdreiirhdphklvegclvggra
mgaraayiyirgefyneasnlqvaireayeagligknacgsgydfdvfvvrgagayicge
etaliesiegkqgkprlkppfpadvgvfgcpttvanvetvavspticrrggawfasfgre
rnsgt

SCOPe Domain Coordinates for d6zke11:

Click to download the PDB-style file with coordinates for d6zke11.
(The format of our PDB-style files is described here.)

Timeline for d6zke11:

  • d6zke11 is new in SCOPe 2.08-stable