Lineage for d6sxnf_ (6sxn F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731887Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2731888Protein automated matches [196409] (46 species)
    not a true protein
  7. 2732101Species Synechococcus sp. [TaxId:32049] [388228] (2 PDB entries)
  8. 2732108Domain d6sxnf_: 6sxn F: [411834]
    Other proteins in same PDB: d6sxna2
    automated match to d6sxla_

Details for d6sxnf_

PDB Entry: 6sxn (more details), 2.66 Å

PDB Description: crystal structure of p212121 apo form of crte
PDB Compounds: (F:) Geranylgeranyl pyrophosphate synthase

SCOPe Domain Sequences for d6sxnf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sxnf_ a.128.1.0 (F:) automated matches {Synechococcus sp. [TaxId: 32049]}
qgfslaqylqeqktivetaldqslvitepvtiyeamrysllaggkrlrpilclaacemlg
gtaamamntacalemihtmslihddlpamdnddlrrgkptnhkvygediailagdallsy
afeyvartpdvpaerllqvivrlgqavgaeglvggqvvdlesegketlnfihthktgall
evcvtagailagakpeevqllsryaqniglafqivddsqaeaqklvaeaiaslepygeka
nplkalaeyivnr

SCOPe Domain Coordinates for d6sxnf_:

Click to download the PDB-style file with coordinates for d6sxnf_.
(The format of our PDB-style files is described here.)

Timeline for d6sxnf_:

  • d6sxnf_ is new in SCOPe 2.08-stable