SCOPe 2.08: Domain d1chma2: 1chm A:157-402

Lineage for d1chma2 (1chm A:157-402)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)

6. Protein Creatinase, catalytic (C-terminal) domain [55922] (2 species)

7. Species Pseudomonas putida [TaxId:303] [55923] (1 PDB entry)

8. Domain d1chma2: 1chm A:157-402 [41142]
   Other proteins in same PDB: d1chma1, d1chmb1
   complexed with cms

Details for d1chma2

PDB Entry: 1chm, 1.9 Å

PDB Description: enzymatic mechanism of creatine amidinohydrolase as deduced from crystal structures

PDB Compounds: (A:) creatine amidinohydrolase

SCOPe Domain Sequences for d1chma2:

Sequence; same for both SEQRES and ATOM records:

>d1chma2 d.127.1.1 (A:157-402) Creatinase, catalytic (C-terminal) domain {Pseudomonas putida [TaxId: 303]}
miksaeehvmirhgariadiggaavvealgdqvpeyevalhatqamvraiadtfedvelm
dtwtwfqsgintdgahnpvttrkvnkgdilslncfpmiagyytalertlfldhcsddhlr
lwqvnvevheaglklikpgarcsdiarelneiflkhdvlqyrtfgyghsfgtlshyygre
aglelredidtvlepgmvvsmepmimlpeglpgaggyrehdilivnengaenitkfpygp
ekniir

Timeline for d1chma2:

• d1chma2 first appeared (with stable ids) in SCOP 1.55
  
• d1chma2 appears in SCOPe 2.07