Lineage for d5ynna_ (5ynn A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893582Family c.66.1.25: mRNA cap methylase [88785] (4 proteins)
  6. 2893632Protein automated matches [190302] (11 species)
    not a true protein
  7. 2893647Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [419989] (12 PDB entries)
  8. 2893650Domain d5ynna_: 5ynn A: [410745]
    Other proteins in same PDB: d5ynnb_
    automated match to d2xyqa_
    complexed with gtg, sfg, zn

Details for d5ynna_

PDB Entry: 5ynn (more details), 1.86 Å

PDB Description: crystal structure of mers-cov nsp16/nsp10complex bound to sinefungin and m7gpppg
PDB Compounds: (A:) nsp16 protein

SCOPe Domain Sequences for d5ynna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ynna_ c.66.1.25 (A:) automated matches {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
asadwkpghampslfkvqnvnlercelanykqsipmprgvhmniakymqlcqylntctla
vpanmrvihfgagsdkgiapgtsvlrqwlptdaiiidndlnefvsdaditlfgdcvtvrv
gqqvdlvisdmydpttknvtgsneskalfftylcnlinnnlalggsvaikitehswsvel
yelmgkfawwtvfctnanasssegfllginylgtikenidggamhanyifwrnstpmnls
tyslfdlskfqlklkgtpvlqlkesqinelvisllsqgkllirdndtlsvstdvl

SCOPe Domain Coordinates for d5ynna_:

Click to download the PDB-style file with coordinates for d5ynna_.
(The format of our PDB-style files is described here.)

Timeline for d5ynna_:

  • d5ynna_ is new in SCOPe 2.08-stable